PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj5g3v2112070.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family HB-PHD
Protein Properties Length: 966aa    MW: 105798 Da    PI: 4.6719
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj5g3v2112070.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox38.22.5e-12823873353
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
         Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                      +R+++ +  +++L + F+ n+yp+++++e LA++lgLt  qV  WF N R 
  Lj5g3v2112070.2 823 TRQRLGDVVVQRLHKSFKDNQYPDRATKESLAEELGLTFFQVDKWFGNARW 873
                      6778888889***************************************96 PP

2PHD41.62.9e-14491546151
                      SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
              PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                      +C++C+     ++++++lCdg C++ fH+ Cl+++l +e++p g   wlC+ C++k
  Lj5g3v2112070.2 491 FCSICQTkeLSTDNDIILCDGaCDRGFHQHCLDPPLLTEDIPPGdeGWLCPGCDCK 546
                      7******77778********66********************9999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579031.37E-13481549IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.102.5E-13488545IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001611.172489546IPR019787Zinc finger, PHD-finger
SMARTSM002491.9E-10491544IPR001965Zinc finger, PHD-type
PfamPF006281.7E-11491546IPR019787Zinc finger, PHD-finger
CDDcd155044.47E-29491543No hitNo description
PROSITE patternPS013590492543IPR019786Zinc finger, PHD-type, conserved site
Gene3DG3DSA:1.10.10.601.1E-14811872IPR009057Homeodomain-like
SuperFamilySSF466895.13E-14817881IPR009057Homeodomain-like
PROSITE profilePS5007114.171818878IPR001356Homeobox domain
SMARTSM003898.6E-15820882IPR001356Homeobox domain
CDDcd000861.20E-13823879No hitNo description
PfamPF000469.3E-10823874IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 966 aa     Download sequence    Send to blast
MISSTGELTS HNNSSIEHME TEQPELSEKT PQIGSECLDG EQRVLGTVST SSVNNENSNQ  60
VSANVTENSV FQLPATPQHC LEKSGQTVTS PPLEESTLKQ VATNVSNGKS ENKCQTSSQD  120
VQNELVEASD VITGSFVADQ TQSIPAQVNT SSVNELLDIP SGDVAVEVGS DSLEKKSKGC  180
LVDSEQRVLG TVLTNSINDG NSNQVSANVT ENSVIQLPAP PQHCFEKSGQ TVKSSSLEES  240
TLKQVSTNLS NSKSENICQT SSQDVQNELV ETSDAVTGSV VADKTQSIPA QVNTSSVNEL  300
LDIPSRDVAE EVGSDSSERK SKSTTPSQLR HIGKSNSKLS KKKYILRSLG SSDRALRSRT  360
KEKPKAPEPS SNSVDVNNDG VKKEKRRKKK KTGGEEKKDQ FYKIKAHLRY LLNRVSYEQN  420
LIDAYSGDGW KGYSMDKLKP DKEIQRAKSE ILRRKLKIRD LFQNLDSLCA EGKFPESLFD  480
SEGEIDSEDI FCSICQTKEL STDNDIILCD GACDRGFHQH CLDPPLLTED IPPGDEGWLC  540
PGCDCKDDCV DLLNDSLGTR LSLSDTWEKV FPEAAAVTGN NMDQGLPSDD SDDDDYNPNG  600
KEDVEVEGGE SSSDESEYAS ASEKLEDSHH EDPYLGLPSE DSEDNDYDPS APDLDNKVTE  660
ESSSSDFTSD SEDLAAAIED NTSPGHVKQT KSRQKSKVGK NPSMVDEVSS LREPELEEEG  720
FTPVSGKRNV ERLDYKKLYD ETYKSDTSED EEWTASATPS RKKKLCGKMT PVSSDGKASN  780
NSRHTPERNT QQDKVENTNN SPTKSLEGCL ESGSRDKKPR SSTRQRLGDV VVQRLHKSFK  840
DNQYPDRATK ESLAEELGLT FFQVDKWFGN ARWGFRRSSR MGASPGEYAS PQATGSGPEN  900
TGERERELAS QEVGEEKLKT PSPRKRKHLS EPQASEAPQI IVLGLAASPG SPRAHAGNKK  960
KTVKRK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1381389KKEKRRKKK
2384390KRRKKKK
3385390RRKKKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.149320.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0061170.0AP006117.1 Lotus japonicus genomic DNA, chromosome 5, clone: LjT09H13, TM0200, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004496910.10.0PREDICTED: homeobox protein HAT3.1
TrEMBLA0A0B2PGL90.0A0A0B2PGL9_GLYSO; Homeobox protein HAT3.1
STRINGGLYMA20G26700.20.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.13e-95Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain